![]() |
DrugMap cysteine engagement data for:
Probe: ![]() KB03 ![]() KB02 | Download Table Download Statistics |
name | peptide | skin_A375 | skin_RPMI7951 | skin_SKMEL2 | skin_HMCB | skin_SKMEL3 | skin_G361 | skin_UACC257 | skin_SKMEL30 | skin_MEWO | skin_UACC62 | skin_LOXIMVI | skin_WM2664 | ovary_TOV21G | ovary_OVTOKO | ovary_EFO21 | ovary_OVK18 | ovary_OV90 | ovary_PEO1 | ovary_OAW28 | ovary_OVCAR4 | ovary_SKOV3 | ovary_OVISE | ovary_NIHOVCAR3 | ovary_EFO27 | bile_duct_ICC21 | bile_duct_ICC137 | bile_duct_ICC10 | bile_duct_ICC106 | bile_duct_SNU245 | bile_duct_ICC11 | bile_duct_ICC108 | bile_duct_ICC24 | bile_duct_TGBC1TKB | bile_duct_ICC20 | bile_duct_ICC8 | bile_duct_KMCH1 | ovary_OVKATE | ovary_OVCAR5 | ovary_A2780 | ovary_CAOV3 | ovary_MCAS | ovary_OVCA429 | ovary_OAW42 | soft_tissue_RKN | bile_duct_ICC26 | bile_duct_TFK1 | bile_duct_ICC3 | bile_duct_ICC18 | lung_MGH0061 | lung_NCIH3122 | lung_MGH0651 | lung_MGH0261 | lung_MGH0732 | lung_MGH0653 | lung_MGH9153 | lung_MGH0752 | lung_MGH97967 | lung_MGH9521R | lung_MGH92431 | lung_MGH91621 | skin_COLO792 | skin_MELJUSO | skin_COLO679 | skin_A2058 | skin_SKMEL28 | skin_IGR1 | skin_HS944T | skin_IGR37 | skin_RVH421 | skin_IPC298 | skin_WM793B | breast_AU565 | breast_CAL148 | breast_ZR751 | breast_MCF7 | breast_HDQP1 | breast_HCC1419 | breast_CAL51 | breast_MDAMB231 | breast_BRX142JUNE | breast_BRX330FEB | breast_BRX50 | breast_BRX82 | breast_BRX394JUNE | breast_BRX29 | breast_BRX330JAN | breast_BRX401 | breast_BRX68 | breast_BRX390 | breast_BRX250MAY | breast_BRX211MAY | skin_MEL182 | skin_MEL167 | skin_IGR39 | fibroblast_HS839T | blood_CMK | blood_THP1 | blood_U937 | blood_MONOMAC1 | blood_KASUMI1 | blood_MOLM13 | blood_P31FUJ | blood_OCIAML5 | bile_duct_SNU1079 | bile_duct_RBE | bile_duct_YSCCC | bile_duct_ETK1 | bile_duct_ECC2 | bile_duct_EGI1 | bile_duct_SNU869 | bile_duct_SNU1196 | bile_duct_OCUG1 | bile_duct_GB2 | bile_duct_SNU308 | bile_duct_G415 | lymphocyte_HT | lymphocyte_A3KAW | lymphocyte_RL | lymphocyte_KARPAS422 | lung_MGH8022 | lung_MGH8021 | lung_MGH8091 | lung_MGH9201 | lung_MGH1701 | lung_MGH100151 | lung_MGH1542 | lung_MGH100164 | bile_duct_CCSW1 | bile_duct_CCLP1 | bile_duct_SG231 | bile_duct_HUCCT1 | skin_CHL1 | skin_COLO829 | skin_A375S2 | skin_A101D | skin_SKMEL24 | skin_SH4 | skin_HS936T | lung_MGH90921 | plasma_cell_KMS12BM | plasma_cell_KMS11 | plasma_cell_KMS27 | plasma_cell_RPMI8226 | ovary_TYKNU | ovary_FUOV1 | lung_ABC1 | lung_A549 | lung_HCC15 | lung_CALU6 | pancreas_CFPAC1 | pancreas_BXPC3 | pancreas_KP4 | pancreas_HUPT4 | breast_HCC1937 | breast_HCC1806 | breast_CAMA1 | breast_BT549 | breast_MDAMB436 | lung_MGH1543 | lung_MGH1541 | lung_MGH8222 | lung_MGH1904 | bile_duct_TKKK | bile_duct_SNU478 | bile_duct_HUH28 | bile_duct_ICC12 | lung_NCIH1703 | lung_LU65 | lung_NCIH1155 | liver_HLF | liver_HUH7 | liver_JHH6 | liver_JHH1 | bile_duct_HKGZCC | bile_duct_TGBC52TKB | bile_duct_ICC9 | bile_duct_MG984 | bile_duct_OZ | bile_duct_SSP25 | bile_duct_ICC19 | bile_duct_ICC4 | brain_MGG75 | brain_MGG23 | brain_MGG123 | kidney_KMRC1 | kidney_CAKI1 | kidney_KMRC20 | kidney_786O | colorectal_SW403 | colorectal_RKO | colorectal_MDST8 | colorectal_SW948 | uterus_HEC1 | uterus_AN3CA | uterus_MFE296 | uterus_RL952 | lung_NCIH2172 | lung_HCC44 | lung_CORL23 | lung_NCIH1299 | colorectal_HCT15 | colorectal_LS513 | colorectal_HT115 | colorectal_HT29 | upper_aerodigestive_DETROIT562 | upper_aerodigestive_BICR22 | upper_aerodigestive_CAL27 | upper_aerodigestive_HSC3 | ovary_OV56 | ovary_IGROV1 | pancreas_SW1990 | pancreas_DANG | pancreas_HUPT3 | pancreas_PATU8988T | prostate_LNCAPCLONEFGC | prostate_DU145 | prostate_VCAP | prostate_PC3 | lung_NCIH1666 | lung_NCIH23 | lung_SW1573 | lung_NCIH1944 | lung_PC14 | lung_HCC827 | lung_LUDLU1 | lung_NCIH1975 | esophagus_KYSE150 | esophagus_TE11 | esophagus_KYSE30 | esophagus_KYSE510 | bone_CAL72 | bone_U2OS | bone_SAOS2 | bone_SJSA1 | uterus_MFE280 | cervix_SISO | uterus_ISHIKAWAHERAKLIO02ER | uterus_SNGM | lung_NCIH2170 | lung_NCIH2122 | lung_NCIH1792 | blood_MOLM16 | blood_MONOMAC6 | blood_JURLMK1 | blood_NOMO1 | blood_KASUMI2 | blood_697 | blood_REH | blood_JM1 | skin_WM115 | skin_C32 | skin_COLO853 | urinary_tract_KU1919 | urinary_tract_HT1376 | urinary_tract_UMUC3 | urinary_tract_J82 | urinary_tract_RT112 | urinary_tract_TCCSUP | urinary_tract_HT1197 | urinary_tract_T24 | breast_MDAMB453 | breast_DU4475 | breast_CAL120 | lung_NCIH1048 | lung_SW1271 | lung_NCIH446 | lung_NCIH2286 | thyroid_8505C | thyroid_8305C | thyroid_FTC133 | thyroid_CAL62 | breast_MDAMB157 | breast_HCC1143 | breast_MDAMB468 | central_nervous_system_GB1 | central_nervous_system_KNS81FD | central_nervous_system_LN229 | central_nervous_system_T98G | liver_SNU449 | liver_SNU423 | liver_HUH1 | liver_JHH4 | liver_SKHEP1 | liver_JHH7 | liver_HEP3B217 | liver_HEPG2 | skin_COLO800 | skin_SKMEL5 | esophagus_KYSE180 | esophagus_KYSE410 | esophagus_TE4 | esophagus_TE1 | ovary_KURAMOCHI | ovary_OVCAR8 | pancreas_PANC0403 | pancreas_MIAPACA2 | pancreas_SUIT2 | blood_MV411 | blood_KO52 | blood_TF1 | blood_OCIAML2 | cervix_HT3 | cervix_CASKI | cervix_C4II | cervix_DOTC24510 | lymphocyte_SUDHL4 | blood_NALM6 | lymphocyte_JEKO1 | blood_JVM3 | skin_A431 | esophagus_OE33 | esophagus_TE10 | lymphocyte_OCILY3 | blood_MEC1 | blood_HG3 | lymphocyte_SUDHL6 | breast_HS578T | breast_KPL1 | breast_HCC1954 | breast_HCC1395 | colorectal_COLO678 | colorectal_LS123 | colorectal_SW1116 | colorectal_CCK81 | bone_SKNMC | bone_A673 | bone_SKES1 | bone_TC71 | central_nervous_system_DAOY | central_nervous_system_D283MED | central_nervous_system_PFSK1 | central_nervous_system_ONS76 | uterus_SKN | uterus_MFE319 | kidney_OSRC2 | kidney_769P | kidney_RCC10RGB | lung_NCIH1793 | lung_NCIH1650 | lung_CALU1 | lung_NCIH358 | skin_WM1552C | skin_MELHO | lung_NCIH2052 | lung_MSTO211H | lung_CORL88 | lung_SBC5 | gastric_KATOIII | gastric_MKN45 | gastric_OCUM1 | gastric_SNU1 | peripheral_nervous_system_SKNAS | peripheral_nervous_system_KPNYN | peripheral_nervous_system_NB1 | peripheral_nervous_system_KELLY | kidney_G401 | soft_tissue_A204 | soft_tissue_KYM1 | kidney_G402 | lung_NCIH196 | lung_NCIH146 | lung_SHP77 | lung_NCIH82 | gastric_HGC27 | gastric_AGS | gastric_NCIN87 | gastric_IM95 | upper_aerodigestive_FADU | upper_aerodigestive_CAL33 | upper_aerodigestive_SCC25 | upper_aerodigestive_HSC4 | cervix_SW756 | bone_CAL78 | lymphocyte_KARPAS299 | gastric_MKN1 | plasma_cell_OPM2 | plasma_cell_SKMM2 | soft_tissue_HT1080 | central_nervous_system_LN18 | breast_HCC1187 | breast_HCC70 | blood_HEL9217 | blood_HEL | blood_EOL1 | gastric_SNU5 | gastric_NUGC3 | soft_tissue_RD | soft_tissue_RH30 | soft_tissue_RH41 | lymphocyte_REC1 | esophagus_TE8 | pancreas_PANC1 | kidney_KMRC3 | lung_NCIH2291 | lymphocyte_L428 | unknown_HDMYZ | skin_MCC13 | skin_MCC26 | prostate_22RV1 | kidney_A498 | kidney_VMRCRCW | colorectal_SW837 | colorectal_LS180 | colorectal_SW620 | colorectal_COLO320 | central_nervous_system_SF295 | central_nervous_system_A172 | central_nervous_system_GAMG | central_nervous_system_KNS42 | blood_JURKAT | blood_PF382 | lymphocyte_DEL | blood_SUPT1 | central_nervous_system_SW1783 | central_nervous_system_42MGBA | central_nervous_system_U87MG | central_nervous_system_U118MG |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
CATITPDEK | 18 | 5 | 12 | 15 | 12 | 32 | 8 | 6 | 1 | 4 | 1 | -3 | 3 | 19 | -17 | -1 | 12 | -6 | -32 | -6 | -19 | -10 | -7 | -4 | -2 | 20 | 7 | 34 | 9 | 31 | 7 | 25 | 3 | 14 | 13 | 8 | -31 | 6 | 15 | 14 | 4 | 5 | 21 | 13 | 4 | 18 | 9 | 9 | 15 | 21 | -8 | 30 | 13 | 1 | -2 | -6 | -3 | -8 | 5 | 11 | 1 | 1 | 6 | 2 | 1 | 2 | 10 | 9 | 28 | 22 | 1 | 15 | 1 | 17 | 7 | 38 | 50 | 8 | 26 | 32 | 20 | 10 | 25 | 16 | 32 | 6 | 20 | 25 | 20 | 12 | 3 | 16 | -21 | -20 | -9 | -24 | -28 | 5 | -18 | 19 | -15 | 0 | 9 | -37 | -15 | -8 | -4 | 5 | 17 | 6 | 34 | -12 | -1 | 10 | 28 | 12 | 18 | 8 | -8 | 7 | 12 | -2 | 0 | 1 | 25 | 18 | 26 | 3 | 9 | 23 | 4 | 2 | 12 | -2 | -37 | 24 | -35 | 4 | 15 | 3 | -4 | -4 | 2 | 21 | -31 | 18 | -14 | -18 | -19 | -15 | -16 | -6 | 7 | 17 | 27 | 18 | 14 | 14 | 23 | 29 | 19 | 1 | 9 | -4 | -7 | 0 | 15 | 6 | -4 | 13 | -2 | 18 | 2 | 21 | 20 | 7 | 8 | 5 | -6 | 7 | -4 | -9 | -5 | 27 | 22 | 19 | 36 | 18 | 7 | -7 | 39 | -7 | -14 | 11 | 6 | 6 | -3 | -7 | 0 | 0 | -14 | 1 | -16 | 11 | 12 | -11 | 4 | -5 | -11 | -10 | 11 | -7 | -11 | -5 | 19 | 6 | 29 | -1 | 21 | 8 | 18 | 6 | -4 | -2 | 18 | -33 | 17 | -39 | -2 | -3 | 10 | -3 | 0 | -20 | 15 | -13 | -25 | -17 | -22 | -33 | -36 | -29 | -45 | -39 | -1 | 9 | -13 | -13 | 0 | -31 | 3 | -12 | 1 | -11 | 19 | 7 | 42 | -3 | -25 | 4 | -36 | -1 | -9 | 7 | -23 | 10 | -5 | 3 | 28 | -7 | -28 | -6 | 14 | -11 | 2 | 14 | 9 | 8 | -11 | -22 | 11 | -3 | 2 | 0 | 33 | 22 | 24 | -3 | -1 | -10 | -22 | -9 | -32 | -21 | -46 | -33 | -25 | -1 | 19 | 7 | -21 | -16 | 4 | -1 | -19 | -1 | -1 | 5 | 3 | 3 | 48 | -12 | -16 | -11 | 25 | 5 | -13 | -1 | -7 | -2 | 10 | -17 | 32 | -4 | 12 | 8 | -5 | 26 | 15 | -9 | -14 | 0 | 1 | 9 | 18 | 21 | 11 | 9 | -9 | -10 | -12 | -6 | -16 | 11 | 11 | -12 | -27 | 1 | -7 | -1 | 9 | 14 | -7 | 25 | 0 | 4 | 38 | 20 | -5 | -7 | 10 | 10 | 29 | 20 | 22 | -11 | -14 | -2 | 46 | -6 | 5 | 15 | 18 | 17 | -11 | -22 | 10 | 4 | 13 | 1 | -1 | 43 | 44 | 39 | -7 | 2 | 4 | -1 | 10 | 11 | 14 | 9 | -4 | -8 | 18 | -8 | 3 | 24 | -19 | 16 | -19 | -12 | 33 | -11 | 20 | -3 | -2 | 19 | ||||||||||
SEGGFIWACK | 63 | 84 | 74 | 89 | 66 | 90 | 92 | 86 | 85 | 86 | 54 | 79 | 88 | 87 | 73 | 77 | 95 | 88 | 42 | 89 | 90 | 86 | 82 | 70 | 87 | 85 | 59 | 69 | 88 | 56 | 74 | 74 | 45 | 76 | 20 | 76 | 5 | 90 | 88 | 81 | 88 | 83 | 89 | 86 | 7 | 85 | 75 | 85 | 31 | 89 | 82 | 82 | 82 | 70 | 77 | 83 | 88 | 89 | 72 | 88 | 47 | 79 | 89 | 90 | 64 | 89 | 52 | 89 | 74 | 79 | 89 | 93 | 91 | 72 | 75 | 76 | 62 | 81 | 90 | 89 | 85 | 91 | 93 | 79 | 85 | 80 | 82 | 89 | 86 | 78 | 59 | 79 | 65 | 89 | 95 | 17 | 85 | 75 | 87 | 30 | 78 | 67 | 70 | 46 | 63 | 82 | 75 | 89 | 81 | 77 | 74 | 78 | 82 | 26 | -25 | 69 | -22 | 93 | 88 | 80 | 63 | 78 | 81 | 89 | 69 | 69 | 24 | 47 | 59 | 56 | 89 | 91 | 86 | 66 | 81 | 85 | 81 | 68 | -57 | 90 | -45 | -44 | 11 | 50 | 90 | 54 | 71 | 56 | 91 | 86 | 73 | 72 | 77 | 68 | 85 | 72 | 83 | 65 | 47 | 67 | 86 | 17 | 40 | 53 | 40 | 69 | 91 | 82 | 73 | 68 | 83 | 69 | 37 | 88 | 50 | 73 | 66 | 91 | 87 | 78 | 88 | 92 | 76 | 93 | 86 | 83 | 89 | 90 | 89 | 93 | 86 | 87 | 51 | 87 | 92 | 89 | 50 | 83 | 76 | 72 | 67 | 73 | 78 | 78 | 41 | 65 | 47 | 84 | 78 | 69 | 86 | 72 | 80 | 91 | 72 | 95 | 63 | 91 | 82 | 83 | 92 | 75 | 93 | 85 | 88 | 88 | 51 | 92 | 88 | 4 | 84 | 22 | 76 | 85 | 95 | 91 | 60 | 91 | 91 | 80 | -15 | 85 | 74 | 80 | -11 | 62 | -26 | -41 | 95 | 92 | 90 | 88 | 80 | 81 | 82 | 95 | 87 | 80 | 85 | 95 | 89 | 82 | 75 | 87 | 86 | 92 | 89 | 83 | 93 | 72 | 74 | 89 | 89 | 29 | 88 | 92 | 83 | 87 | 95 | 95 | 75 | 84 | 88 | 92 | 86 | 67 | 71 | 95 | 95 | 95 | 79 | 90 | 85 | 58 | 73 | 93 | 77 | 92 | 56 | 74 | 82 | 89 | 84 | 85 | -17 | 89 | 73 | 91 | 87 | 87 | 87 | 82 | 83 | 53 | 79 | 84 | 87 | 94 | 93 | 85 | 91 | 87 | 79 | 91 | 79 | 92 | 51 | 86 | 90 | 78 | 90 | 93 | 92 | 59 | 87 | 84 | 88 | 81 | 82 | 81 | 86 | 91 | 66 | 89 | 86 | 72 | 90 | 88 | 84 | 78 | 71 | 82 | 71 | 80 | 80 | 74 | 88 | 82 | 74 | 88 | 72 | 63 | 81 | 80 | 93 | 83 | 91 | 92 | -21 | -25 | 56 | 77 | 69 | 91 | 93 | 93 | 79 | 67 | 85 | 86 | 73 | 81 | 79 | 67 | 90 | 89 | 69 | 71 | 70 | 63 | 56 | 55 | 74 | 88 | 73 | 89 | 92 | 55 | 79 | 75 | 79 | 67 | 79 | 36 | 16 | 88 | 9 | 81 | 76 | 76 | 80 | |||||||
NYDGDVQSDSVAQGYGSLGMMTSVLVCPDGK | 28 | -11 | 4 | 11 | 4 | 21 | -17 | -14 | 0 | -20 | 19 | -6 | 34 | 17 | 12 | -16 | 17 | 17 | -9 | 7 | -12 | 15 | 15 | 14 | 11 | 2 | 21 | -3 | 28 | -13 | 6 | 7 | 0 | 4 | 10 | 11 | -8 | 60 | -30 | -14 | 21 | 0 | 5 | 8 | 0 | 6 | 5 | 18 | 13 | 26 | 19 | 18 | -21 | 2 | -17 | -7 | -17 | -24 | -43 | -26 | 19 | 1 | -17 | 17 | 30 | 6 | -9 | -2 | -13 | -34 | -26 | -10 | -2 | 0 | 4 | -4 | 8 | 11 | -3 | 5 | -10 | -18 | -7 | -13 | -6 | 36 | 10 | -25 | -6 | 2 | 19 | 28 | -18 | -5 | 9 | 6 | 1 | 11 | 13 | -13 | 13 | 21 | 4 | 3 | 16 | 19 | -8 | 3 | -8 | -7 | 11 | -10 | -11 | -41 | -37 | -19 | 2 | -11 | -4 | -17 | 10 | 1 | -12 | 5 | -13 | 6 | 15 | 42 | 0 | 5 | 16 | -22 | -10 | 15 | -21 | 2 | -13 | 2 | -4 | -3 | 2 | 7 | -5 | -7 | -9 | 11 | 21 | 11 | 16 | -7 | -4 | 2 | -6 | 23 | -30 | 7 | -12 | -11 | -31 | 9 | 10 | -3 | -24 | -11 | -9 | -28 | -28 | -26 | -24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
DLAACIK | -6 | 14 | -14 | -6 | 15 | 18 | 23 | -1 | 2 | 5 | -1 | 9 | 1 | 17 | 2 | 13 | 4 | -5 | 1 | 19 | -7 | 15 | 12 | 1 | 14 | 37 | 31 | 33 | 5 | 42 | 13 | 46 | -8 | 21 | -6 | -6 | 22 | 21 | 12 | 43 | 3 | 7 | 2 | -2 | -1 | 13 | 7 | 18 | -11 | 11 | 11 | -9 | 10 | 18 | 8 | 38 | 19 | 18 | 3 | 16 | 0 | 22 | -4 | 37 | 34 | 24 | 0 | 18 | 34 | 10 | 23 | 14 | 15 | 20 | 18 | 20 | 19 | 7 | 15 | 20 | 23 | 16 | 16 | 15 | 19 | 15 | 12 | 17 | 35 | 13 | 5 | -15 | 17 | 0 | 34 | -27 | 14 | -17 | 47 | 15 | 0 | 3 | 32 | 16 | 32 | 18 | -14 | -1 | -29 | -9 | -17 | 5 | -10 | 12 | 42 | 32 | -16 | -16 | 10 | -3 | -8 | -4 | -22 | -19 | -10 | 0 | 12 | 23 | 40 | 24 | 14 | 20 | 16 | -12 | -30 | 3 | -44 | -28 | 3 | 9 | 20 | 6 | 10 | 10 | 55 | 17 | 31 | 15 | 39 | 15 | 42 | 28 | 37 | -3 | -3 | 2 | 1 | -33 | -33 | 23 | -19 | 25 | 17 | 14 | 16 | 20 | 19 | 4 | -4 | 30 | -5 | 17 | 20 | 38 | 46 | 16 | 8 | 13 | 12 | 32 | 45 | 38 | 34 | 20 | 17 | 13 | 36 | 11 | 13 | 14 | 25 | 11 | 36 | 13 | 37 | 9 | 28 | 39 | 24 | 58 | 34 | 42 | 14 | 59 | 58 | 36 | 41 | 38 | 53 | 65 | 54 | 51 | 45 | 74 | 64 | 58 | 71 | 44 | 23 | 42 | 19 | 21 | 25 | 12 | 7 | 17 | 28 | 23 | 44 | 57 | 33 | 49 | 29 | 35 | 14 | 21 | -9 | 43 | 36 | 29 | 69 | 8 | 30 | 4 | 16 | 25 | 24 | 48 | 55 | 40 | 22 | 56 | 40 | 37 | 41 | 14 | 14 | 24 | 41 | 29 | 44 | 56 | 33 | 27 | 62 | 54 | 44 | 46 | 46 | 17 | 6 | 26 | 16 | 35 | 59 | 42 | 63 | 62 | 46 | 60 | 14 | 38 | 4 | 57 | -5 | 49 | 45 | 61 | 41 | 67 | 24 | 29 | 29 | 33 | 44 | 36 | 17 | 17 | 19 | 4 | 37 | 23 | 30 | 23 | 28 | 10 | 31 | 51 | 20 | 31 | 24 | 34 | 26 | 38 | 35 | 28 | 45 | 26 | 35 | 43 | 26 | 21 | 34 | 33 | 22 | 14 | 20 | 15 | 25 | 19 | 45 | 24 | 29 | 27 | 11 | 36 | 7 | 16 | 42 | 25 | 35 | 26 | 37 | -20 | -25 | 12 | 37 | 15 | 23 | 9 | 10 | 8 | 11 | 25 | 36 | 28 | 7 | 29 | 34 | 44 | 34 | 6 | 17 | 12 | 10 | 25 | 12 | 23 | 24 | 30 | 31 | 27 | 11 | 55 | 6 | 39 | -9 | -17 | 48 | -17 | 20 | 29 | 1 | 26 | ||||||||||||||||||||||||||||||||||
IDH1 | DNA copy number | 0.824027660579488 | 1.19350135583118 | 0.984125311168505 | 1.08692028590817 | 1.08292262115088 | 1.038530671548 | 1.17022830756212 | 1.04128327341275 | 0.99786707901998 | 1.06416587760332 | 1.17800239540755 | 1.13624866661037 | 0.986524032265704 | 0.673670741161023 | 1.08795579767778 | 1.01230150282912 | 1.09378569494739 | 0.854806259207464 | 1.08559139131775 | 1.06981663311065 | 1.02889519276017 | 0.984473459486743 | 1.02141917813635 | 1.06994963828409 | 1.15225137146438 | 1.46815467279813 | 1.10724744556466 | 1.45869741139606 | 0.868969209924926 | 0.984907281418218 | 1.14368064437271 | 1.26311209147842 | 1.14863667411714 | 1.01427240657851 | 0.965360113373922 | 1.08390381041791 | 0.912290735250293 | 1.11023518045891 | 1.01034079624257 | 1.03371241276721 | 1.05008685324904 | 0.966569047741058 | 1.27978490166936 | 0.971955981189458 | 1.29734687903946 | 0.973430752441805 | 1.07202785090399 | 1.02251803693759 | 1.00290742373451 | 1.08924316874728 | 0.942421428008213 | 0.996875889922441 | 1.01578694156193 | 1.07210650535547 | 0.574828200835573 | 0.920326749114662 | 1.05917752176299 | 0.824400635745334 | 1.04860411785864 | 0.99397314142895 | 1.03919486752213 | 0.995276258761028 | 0.853981277598485 | 0.991028072278733 | 0.588862328635285 | 0.96633859961425 | 1.00233989445498 | 0.978754277773576 | 1.12368095792377 | 1.0422418657843 | 0.732637173291469 | 0.982329558981228 | 1.01210133111921 | 1.02835885835714 | 1.11213592936955 | 0.991571763653492 | 0.961402052820288 | 0.980406386989766 | 0.849472112607162 | 0.996578067895375 | 1.02272978106801 | 0.977351613878292 | 0.971399732102062 | 0.710845276669335 | 1.0005761149848 | 1.07561214256477 | 0.959931842663491 | 1.01462841968515 | 1.16450644916802 | 1.01887386484088 | 1.23785602711205 | 1.0121865394156 | 0.896484266398434 | 1.0250390846523 | 1.00850391622453 | 1.0585899255203 | 1.13951829148311 | 0.794960591643935 | 0.965045974245323 | 1.10734496787736 | 1.1266215517935 | 1.1243504038117 | 0.987240923913617 | 0.875612572940359 | 1.02504874814083 | 0.966407437068265 | 1.03827205234948 | 0.940417081144994 | 0.889983197231217 | 0.787499576098893 | 0.673440202233623 | 0.999200721529914 | 1.03224651538258 | 0.915592964497362 | 0.958983659036596 | 0.924552217569738 | 0.952766456193214 | 0.980417236618773 | 1.10682527198837 | 0.891795663165402 | 0.96323035200209 | 1.05399818780296 | 0.934262966320338 | 1.02818046260485 | 0.945872115998357 | 0.932172438129792 | 1.17658943622592 | 1.16049253525061 | 1.02223322005813 | 0.970222299069836 | 1.06930984951501 | 0.998206116668484 | 1.00262338083484 | 1.07477151531445 | 1.29668861196001 | 0.87939982897212 | 0.985108160871862 | 1.02112544082227 | 1.02921851348696 | 1.08949387433767 | 0.858758241071939 | 1.02484226825873 | 1.05038781201276 | 1.00824140590245 | 0.957815852724277 | 1.02702548167687 | 1.01425271475023 | 1.06547079536624 | 0.921060312534492 | 1.05354468165827 | 0.821211981676291 | 1.07354394444627 | 1.0500335968934 | 1.1652654298081 | 1.08378548688086 | 1.02114522441289 | 1.03306595397539 | 0.850592750694412 | 0.947637163851393 | 1.043641749509 | 1.01897618108924 | 1.22597718365712 | 0.926333453144486 | 0.952013592671923 | 0.762375361717907 | 1.08872438920077 | 0.92646896874445 | 1.04165295960632 | 0.737278245256709 | 1.13318053236468 | 0.756866777012073 | 1.04200936216682 | 1.21878523953209 | 1.03006182065123 | 1.15999964835167 | 1.03369860102415 | 0.955773392213213 | 0.849423607291152 | 1.0320216693488 | 1.01613523188908 | 1.20442719435352 | 0.951786076715442 | 1.03413859265392 | 0.906196889355647 | 0.994979765119816 | 1.00475079652242 | 0.987346977385183 | 0.983412962856292 | 0.986282837960844 | 0.990312246839306 | 0.933629121211184 | 1.02432314332675 | 1.31152494095919 | 0.991113538352934 | 0.844527511239922 | 0.884940899767517 | 1.19401297476126 | 1.0232681631558 | 0.816104825934786 | 0.708916121726099 | 0.958489427477776 | 1.2420912954233 | 1.02605612819821 | 0.977891539458843 | 1.02840626422531 | 1.01275186292701 | 1.0127992772911 | 1.08497069805461 | 0.870182877937909 | 0.984818230700062 | 0.851373875647825 | 0.876611662858905 | 1.12055963961282 | 0.89505085879698 | 1.0677789659692 | 0.793583382575097 | 1.07365259202325 | 0.819042641610461 | 1.24585098026106 | 1.00036354579355 | 1.37232553595852 | 1.06825439636111 | 1.15275476412851 | 0.999284677424963 | 1.06921563076043 | 1.30732187822849 | 1.08961102486279 | 0.973923509062508 | 0.902361385193453 | 1.00754814311702 | 1.22797506811369 | 0.922501764997818 | 1.1150898812793 | 0.560247707880471 | 1.06947369880089 | 1.03866410341283 | 1.07563789375706 | 0.991526033905695 | 0.993840206468327 | 0.91345166466073 | 0.98269899844997 | 0.737009395452008 | 0.940568906774255 | 0.583982500507944 | 0.686709478848127 | 0.959809882498855 | 0.977282723153623 | 0.859592434592854 | 0.89743338032866 | 0.860591193997293 | 1.04987332185458 | 0.822338438039534 | 1.01190219493464 | 0.957569896702332 | 1.00593515843593 | 0.989757617907489 | 1.06402709797967 | 1.07239546276033 | 0.816017128031762 | 0.86072778096512 | 0.918053708911766 | 0.809221457707818 | 1.05537973540379 | 1.06339804764581 | 0.994074718038369 | 1.09536438913863 | 0.931569571802736 | 1.0649492205576 | 1.01491783846064 | 1.03181984749549 | 0.946482978668683 | 0.940832367878676 | 0.930660325754073 | 1.04099642982312 | 0.757225258579712 | 1.04033144804474 | 1.06584158909477 | 1.22996010026248 | 1.05798436068343 | 1.08602136354867 | 1.00052809661917 | 0.964583676523355 | 1.15800904514371 | 1.10280125917974 | 1.00108790987738 | 1.07812141459757 | 0.924799701781745 | 1.10262972937183 | 0.97406390794381 | 1.0291221219482 | 1.03234668486571 | 0.982497473995091 | 0.917060282379786 | 0.979196193804431 | 0.998286518756381 | 1.0261665742765 | 1.03158331603 | 1.33420177170065 | 0.938795500426624 | 0.786749400520508 | 1.01227124842595 | 1.16361824093556 | 1.07036705370251 | 1.00645989816831 | 1.04208651652526 | 1.02391956081259 | 1.03635277070503 | 0.984368115778977 | 1.0177159556873 | 0.885460938415733 | 0.912485243702924 | 0.855694011731953 | 1.02652647130806 | 1.01483550237347 | 0.980263870103764 | 0.996654388257689 | 0.993272757967612 | 0.944206890429428 | 0.91990048365018 | 1.02041391408588 | 1.0798846190169 | 1.0779319380575 | 0.974201375120762 | 1.02682280230089 | 1.24895389434263 | 1.43211097304701 | 0.947595753851438 | 0.651644781431541 | 0.926151050619946 | 0.902883212160056 | 1.0755926980619 | 1.00863317715789 | 1.0031414127227 | 1.13492685927509 | 1.16613172508081 | 0.988188748353511 | 1.05813456044617 | 0.983401595883584 | 1.07906807989419 | 1.25343884012182 | 1.01530887142267 | 1.03700627438228 | 0.980913450150758 | 0.91804335184845 | 1.01867887572737 | 1.05084763711024 | 1.06560343550148 | 1.09868891619636 | 0.966395231594796 | 0.966779511830501 | 0.783244095836097 | 0.839744869652971 | 0.730779006010328 | 1.15154356388325 | 1.05562256653415 | 0.94086063317759 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
IDH1 | DNA mutation status | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 | 0 | 0 | 2 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
IDH1 | RNA expression | 6.59514556799086 | 6.66618848987278 | 5.77584069853125 | 7.52026508364357 | 7.0287901363499 | 7.70348834965682 | 6.73281187208294 | 7.4194546194824 | 6.71740225068988 | 6.13422093976063 | 6.48992821940518 | 6.16671544496642 | 6.15015345524625 | 4.73335434061383 | 8.43287591556389 | 7.67588648378205 | 9.17888889323605 | 4.8972404255748 | 6.57455568565992 | 6.38422253293016 | 7.41303549858812 | 6.36597242759338 | 5.95953834111265 | 8.56544485625942 | 7.01825582653616 | 9.31124879044183 | 8.58590144969077 | 7.90556751865141 | 8.03320272593722 | 7.3327079336406 | 8.630121482845 | 7.48880418737256 | 7.39566265490837 | 6.17072627613155 | 6.83352263642477 | 5.83339613416323 | 5.6507645591169 | 5.97682185236069 | 9.45168506234387 | 6.83832152141272 | 6.73768676140986 | 5.63343121035563 | 6.69877410890368 | 5.89602960297675 | 6.83769100042856 | 6.51159454153741 | 6.9048453285608 | 7.45680614923047 | 7.84643063233652 | 6.95349806319688 | 7.35288208652296 | 6.35226417325832 | 7.1048607997082 | 6.260590274731 | 5.85174904141606 | 6.95279947789994 | 6.73687542290827 | 4.8860623383456 | 6.65592421308382 | 6.22265002245148 | 6.44194819050336 | 6.62702310555406 | 7.55933884760654 | 6.86789646399265 | 4.87970576628229 | 6.70501025298183 | 7.6818006194096 | 5.53231695933277 | 5.999774561287 | 6.36981542428391 | 8.61886265071249 | 7.37321317980804 | 7.89050749277435 | 8.07489072012634 | 6.3037807481771 | 6.63720448190229 | 6.82959589917751 | 7.3467796432283 | 5.8592241619782 | 5.14730669878029 | 5.27500704749987 | 4.74092756031863 | 5.5915597458278 | 6.55658268982325 | 6.06824086131282 | 7.48832219114082 | 5.77478705960117 | 6.21140163741847 | 6.50716034911752 | 5.25512301484779 | 8.61072958653471 | 7.58586390346269 | 4.04526821513853 | 4.84297883178833 | 6.67496903062497 | 4.22032995487956 | 5.95046841415012 | 4.3533232911629 | 6.18705508996806 | 7.23716214902522 | 6.816727690127 | 6.07339181605292 | 6.71342088486808 | 6.01703108052784 | 6.76075320806299 | 7.49641441234776 | 7.67327373660982 | 5.97682185236069 | 5.18745105402733 | 5.68425770505893 | 5.9413411054853 | 8.43600355269717 | 7.49761236561836 | 5.65105169117893 | 5.98481717429359 | 5.91288933622996 | 6.9469647411558 | 5.78842470743944 | 6.72055209160511 | 8.19071361744271 | 7.12753010848538 | 6.65391987311942 | 6.54395979737185 | 6.81519113717349 | 4.47183776242229 | 7.20231976231248 | 7.290848273342 | 6.27649666564036 | 6.0706039986813 | 7.03430376776804 | 6.55182359572126 | 7.13370736065839 | 5.41650199286742 | 6.9442728176116 | 7.98208090976374 | 5.44493204894218 | 6.51475349843975 | 7.77188557851536 | 6.89651405396884 | 6.97968241371522 | 4.72900887033786 | 5.60880924267552 | 5.26865895502767 | 7.24174486494015 | 6.87590290312483 | 6.83756486315715 | 6.94239720829126 | 5.58165253046128 | 5.35966172233388 | 7.53177132541286 | 4.70653055253812 | 5.74173662382664 | 6.57833494868161 | 5.42122329922514 | 6.03518399661834 | 5.48317085322987 | 6.81429405828283 | 7.868822554775 | 8.19204617885329 | 5.57046293102604 | 6.04766925139131 | 4.50525580093216 | 5.06047978140759 | 8.59659976623488 | 7.10286805425111 | 6.61264737765832 | 7.60162224073039 | 6.48236429255538 | 7.51293794347466 | 6.55105452750064 | 6.99197527423717 | 7.88539133157044 | 7.35816765770672 | 5.98868468677217 | 5.88728155166999 | 6.14567745519564 | 6.00898878322726 | 7.57818396809009 | 6.92291140625819 | 6.17432651517391 | 7.24659810305712 | 8.52919626799939 | 7.1365810516665 | 7.31170291082736 | 7.32606989214514 | 6.03121873061072 | 6.24944534108584 | 4.99774402605963 | 5.25209770303744 | 5.50207595604579 | 4.61470984411521 | 6.01077983875324 | 7.5454278748237 | 5.24678809384436 | 4.52356195605701 | 5.64125699872677 | 6.96254902292306 | 7.97378345195419 | 6.85524225145415 | 6.95791459863299 | 6.3127014727958 | 6.68299458368168 | 5.70597790168252 | 5.63778411029132 | 6.24241196309824 | 4.268284666521 | 6.53558643635484 | 4.88752527074159 | 4.74308405554959 | 5.8171115727957 | 4.9560566524124 | 4.5765221379205 | 5.48832219114082 | 5.45121111183233 | 6.89530262133331 | 5.09423606984577 | 6.36299581197405 | 6.81634370528486 | 6.90122894538153 | 5.26228280642066 | 8.90122894538153 | 5.99638874644762 | 5.87282875953489 | 8.59827586790765 | 6.95046841415012 | 8.40594982676583 | 6.6321227752009 | 7.22168378101097 | 5.14159627838382 | 6.38612115681485 | 7.53745138765307 | 5.23035674505615 | 5.87258254483322 | 3.95140129167431 | 7.15491934725718 | 5.19613488076516 | 6.86727873970966 | 6.01033228328482 | 5.4432751117658 | 6.24450655139592 | 6.03869955130559 | 5.62614706360372 | 5.47929524299885 | 5.59215800212536 | 5.92219784839637 | 4.66618848987278 | 5.62643913669732 | 5.0408924306469 | 5.05006629830629 | 6.63720448190229 | 6.6796208433757 | 5.96254902292306 | 4.06004738366994 | 4.95279947789994 | 3.41006969175638 | 5.46825746832314 | 6.03276207381379 | 5.83466065790173 | 8.3653163489508 | 5.72383156649532 | 7.31650781910311 | 5.47702965301306 | 6.07339181605292 | 9.00121112990446 | 6.46907195208039 | 6.96162332828694 | 6.39163026151743 | 7.16711703022744 | 5.4966540825935 | 7.99542798583254 | 5.84949893172018 | 5.62556273996637 | 3.95326523901484 | 5.99774402605963 | 5.46466826700344 | 5.68481873755322 | 4.75968848842729 | 8.26847182291237 | 6.97119864538455 | 6.60080495498947 | 6.73335434061383 | 6.75060650483559 | 6.57152513094636 | 6.16490692667569 | 6.161686174584 | 6.51790555352995 | 7.06695024392463 | 7.09940041455047 | 7.18437948621294 | 5.65963918701565 | 5.92338691550471 | 5.48478262307787 | 6.38784501296558 | 5.81941272620656 | 9.25495773198926 | 6.41396635150775 | 5.69627208392586 | 5.67440415393769 | 6.492974756328 | 4.90785207184596 | 5.86492897228979 | 6.66320227857954 | 6.80658184262093 | 7.95541743038314 | 6.09697863637054 | 7.83409175937449 | 7.34349665546436 | 6.91552090075196 | 4.40463068421761 | 5.40258575823259 | 5.5837597536395 | 6.40956065498278 | 6.9469647411558 | 7.89439337882455 | 7.4826869709376 | 5.42995065740377 | 5.49857001254426 | 6.54318652456517 | 7.20779526344899 | 8.83819543925919 | 5.84172158112846 | 6.73335434061383 | 5.56803210477128 | 7.00213991262754 | 6.33788945585985 | 6.63705953841085 | 5.47670570666818 | 3.45680614923047 | 5.51412226017071 | 4.9217219470096 | 5.66305992374782 | 6.59081157641784 | 6.39711840904258 | 6.39077084942262 | 6.02480723340057 | 6.62775273437702 | 6.63763922502473 | 8.59077415776056 | 7.44111824453277 | 8.15162546368377 | 6.86863738417031 | 7.57621978120958 | 5.45713459431804 | 5.81224149518948 | 6.89772447021644 | 6.59111089074275 | 6.4417822395006 | 6.57561487761963 | 5.06091204958787 | 4.90110824301451 | 5.00629802390037 | 4.73822740036724 | 5.38439523838807 | 6.5216789516032 | 6.92326805288542 | 6.67058544026221 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
IDH1 | CRISPR gene dependency | 0.01 | 0.12 | 0.05 | 0.02 | 0.06 | 0.02 | 0.03 | 0.63 | 0.03 | 0.06 | 0.62 | 0.01 | 0.02 | 0.05 | 0.02 | 0.19 | 0.01 | 0.01 | 0.01 | 0.03 | 0.02 | 0.01 | 0.02 | 0.03 | 0.07 | 0.01 | 0.05 | 0.23 | 0.04 | 0.06 | 0.04 | 0.24 | 0.17 | 0.04 | 0.04 | 0.02 | 0.03 | 0.01 | 0.12 | 0.02 | 0.04 | 0.02 | 0.15 | 0.02 | 0.13 | 0.01 | 0.06 | 0.01 | 0.02 | 0.02 | 0.01 | 0.01 | 0.02 | 0.02 | 0.01 | 0.34 | 0.01 | 0.10 | 0.01 | 0.00 | 0.23 | 0.02 | 0.17 | 0.02 | 0.02 | 0.40 | 0.06 | 0.01 | 0.03 | 0.02 | 0.01 | 0.01 | 0.07 | 0.06 | 0.02 | 0.02 | 0.04 | 0.00 | 0.01 | 0.01 | 0.06 | 0.06 | 0.11 | 0.09 | 0.13 | 0.04 | 0.29 | 0.12 | 0.04 | 0.08 | 0.01 | 0.01 | 0.04 | 0.10 | 0.06 | 0.15 | 0.04 | 0.02 | 0.03 | 0.02 | 0.02 | 0.03 | 0.06 | 0.01 | 0.03 | 0.02 | 0.01 | 0.01 | 0.02 | 0.01 | 0.19 | 0.06 | 0.15 | 0.01 | 0.02 | 0.05 | 0.31 | 0.05 | 0.01 | 0.05 | 0.12 | 0.02 | 0.06 | 0.00 | 0.07 | 0.05 | 0.06 | 0.06 | 0.01 | 0.09 | 0.16 | 0.02 | 0.07 | 0.17 | 0.05 | 0.09 | 0.06 | 0.03 | 0.16 | 0.19 | 0.02 | 0.08 | 0.02 | 0.02 | 0.00 | 0.04 | 0.00 | 0.01 | 0.02 | 0.05 | 0.06 | 0.01 | 0.06 | 0.02 | 0.06 | 0.08 | 0.02 | 0.05 | 0.04 | 0.16 | 0.25 | 0.01 | 0.11 | 0.01 | 0.01 | 0.10 | 0.18 | 0.04 | 0.01 | 0.05 | 0.04 | 0.05 | 0.04 | 0.00 | 0.05 | 0.07 | 0.11 | 0.25 | 0.04 | 0.02 | 0.14 | 0.17 | 0.02 | 0.01 | 0.01 | 0.02 | 0.05 | 0.06 | 0.04 | 0.02 | 0.06 | 0.06 | 0.03 | 0.02 | 0.01 | 0.02 | 0.04 | 0.05 | 0.01 | 0.10 | 0.01 | 0.02 | 0.01 | 0.04 | 0.03 | 0.02 | 0.02 | 0.07 | 0.05 | 0.09 | 0.01 | 0.04 | 0.03 | 0.03 | 0.06 | 0.01 | 0.04 | 0.02 | 0.01 | 0.01 | 0.03 | 0.11 | 0.02 | 0.01 | 0.00 | 0.29 | 0.03 | 0.07 | 0.05 | 0.01 | 0.17 | 0.03 | 0.10 | 0.14 | 0.02 | 0.03 | 0.07 | 0.02 | 0.00 | 0.13 | 0.01 | 0.04 | 0.01 | 0.03 | 0.23 | 0.10 | 0.01 | 0.04 | 0.02 | 0.04 | 0.18 | 0.00 | 0.00 | 0.03 | 0.02 | 0.03 | 0.05 | 0.10 | 0.03 | 0.04 | 0.01 | 0.01 | 0.07 | 0.07 | 0.06 | 0.01 | 0.04 | 0.03 | 0.01 | 0.02 | 0.02 | 0.01 | 0.02 | 0.01 | 0.01 | 0.02 | 0.03 | 0.41 | 0.03 | 0.02 | 0.05 | 0.12 | 0.33 | 0.03 | 0.01 | 0.02 | 0.03 | 0.11 | 0.06 | 0.02 | 0.03 | 0.09 | 0.04 | 0.01 | 0.03 | 0.03 | 0.08 | 0.02 | 0.05 | 0.03 | 0.02 | 0.44 | 0.05 | 0.05 | 0.06 | 0.17 | 0.09 | 0.00 | 0.03 | 0.01 | 0.02 | 0.01 | 0.06 |
Structural information (To highlight a cysteine, click a "CYS" button)
Cysteine | Gene | Uniprot Accession | pdb | Depth (Å) | Absolute SASA (Å^2) | Half-Sphere Exposure (up) | Half-Sphere Exposure (down) | Coordination Number | Relative SASA | Estimated h_nho1 energy (DSSP) | Estimated h_ohn1 energy (DSSP) | Estimated h_nho2 energy (DSSP) | Estimated h_ohn2 energy (DSSP) | TCO (DSSP) | Kappa (DSSP) | Alpha (DSSP) | Phi (DSSP) | Psi (DSSP) | Structural Motif (DSSP) | Pocket Volume (Å^3) | Presence at Interface | Local Basic Content (Fraction of Local Neighbors) | Local Acidic Content (Fraction of Local Neighbors) | Local Polar Content (Fraction of Local Neighbors) | Local Cysteine Content (Fraction of Local Neighbors) | Local Structural Content (Fraction of Local Neighbors) | Local Aliphatic Content (Fraction of Local Neighbors) | Local Aromatic Content (Fraction of Local Neighbors) |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
IDH1 | O75874 | 6bkx | 4.7 | 0.0 | 24.0 | 22.0 | 46.0 | 0.0 | -2.6 | -0.1 | -0.4 | -0.1 | -0.5 | 44.3 | -86.4 | -80.0 | 151.3 | N/A | 0.0 | 0.0 | 0.1 | 0.0 | 0.3 | 0.0 | 0.1 | 0.4 | 0.1 | |
IDH1 | O75874 | 6bkx | 10.3 | 0.0 | 20.0 | 25.0 | 45.0 | 0.0 | -2.8 | -3.0 | -0.6 | -0.1 | -1.0 | 27.2 | -118.1 | -117.7 | 141.4 | E | 0.0 | 0.0 | 0.1 | 0.1 | 0.1 | 0.0 | 0.3 | 0.1 | 0.1 | |
IDH1 | O75874 | 6bkx | 2.2 | 9.2 | 18.0 | 17.0 | 35.0 | 0.0 | -2.6 | -1.5 | -0.6 | -0.2 | -0.4 | 19.5 | -113.0 | -77.6 | 157.7 | N/A | 0.0 | 0.0 | 0.0 | 0.1 | 0.1 | 0.0 | 0.5 | 0.3 | 0.0 | |
IDH1 | O75874 | 6bkx | 1.8 | 41.3 | 19.0 | 13.0 | 32.0 | 0.2 | -0.9 | -0.2 | -0.6 | -0.2 | 0.9 | 113.1 | 37.7 | -63.4 | -37.0 | H | 0.0 | 0.0 | 0.0 | 0.0 | 0.0 | 0.0 | 0.2 | 0.8 | 0.0 |
Using this data? Please cite Takahashi, Chong, Zhang, et al. (2024) Cell
and Lawrence Lab